1. Notes: 6 / 4 months ago 

    Our Website for Snark NYC

    I bought the domain
    I setup the web hosting
    I have created websites before
    Noticed I didn’t use the word “designed”
    I am drinking an energy drink at 11PM
    I am exhausted
    I have an 8AM staff meeting tomorrow
    I don’t think I am going to make any progress on this site again tonight
    Luckily I have a good head start on not getting this thing done.

  2. Notes

    1. roughdiction posted this
avatar_128
 
 
The most important thing is knowing when to blame someone else for your mistakes.
 
 

Following

nevverchopadaddynobuckssleekgeekcoocoocahzuuuuknitterpleasejinxybeehoteatsmissdisgracelafixt-gibbyzhubiruthakersyournewfavoritelilykilyconasabigirlgoesgrrrtitsandsasstheworldweliveinfancyglassescynicaljessgirl-detectivemorrowplanethellamikeaimee-b-lovedlunchypricesdonthenerdaka-lindsayloooslashleenthereamc-petersonbrianlaboradaryanjjohnblanddiva11mrsevilvixenimpeccablepeccadillokalamazuredlemuri-am-randomismsnerdymchotpantspvarasdannisaurbananacastsonzoabangnotawhimperbeeborgchangingstephaniekellydealcameronrmisscookdkelleydoogiehowsermdtheclearlydopenotwhatihadinmindverlierenhyperbolicelestejezebelthegreattattoosbyshoeyashamedtosaysarkastickuntgrovervioletnopantsonfactualfictiondavio1962tweetfaceplatypusjonestheoriginaljoefishercloudyanikiwithissuesdailybezeverydaydudeblueeyedlondongirlpoptechminusmanhattangirl11elevenhellonewyorkdoom-dragonedgellacedysolutionbtothedapricoticaohyeahfactssparkgrrl658museumofusefulthingslaurenystavvtherealcherilynshiraselkotheimpossiblecoolgiantrascalcordisrebeyondneptuneinthefadefourthdimensionalpenistastethesoupimjessicablackazzrsmallbonepledgingmylovejillzeymaxistotallyradrocketboomthevoidofmanifestationbaileyalisonagostibiorhythmistclassymalcolmthedrew84deviantpixelhomedesigningexplodingdogjohnryangallagheryowhatsthehapscourtneyconundrumfuckyeahjapanesedascolacreativelymaladjustedplemursunnybucketpikkutiikerimoxienicdamselesqueatsweenoverlandparkerbliccyrobynchellonehelloworldthedutydubstepfridaysusanimateworldwarmikelinanneblackwordnonsensejephkelleysharqubusiamnotdiddyaswxddwilhitesamgrittnersistacrumpetsenatorcocainepatrickmarkryangdubhisnameslensinfullysarahxytrexjas508jasonmaybebrogrecycledsanitarynapkinstensexyladiesmonikkabfavstarmelissasantosgoldengateblondvytrevinomarinatisenoritaperdidaawryoneactionfiguretherapyshasugabogusflowsensuallymoonstruckmojo1000jemoiellemikeyadhdaclkwrkstarfishfunsizdprincesspearlslaceandrufflesballoonadriftnavanaxfaithannarexhuppkeaimee-l-brockwoeismehtiffanyjmoorebettyliessocialismandrumsunnynunchucksrenderman420misscrisselinhaydenhunterfuckoffshellyskinnyisboringsnapefacethemenguidecurvyliciousdivasbeaubocksubsistingtsaphanbabesweetlikeantifreezefuckyeahgirlswithtatstheb1ueguysuspndedaslowdeath
 

Tumblr